OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Complement factor 8 beta (C8B) (NM_000066) Human Mass Spec Standard

Be the first to review this product
SKU
PH319942
C8B MS Standard C13 and N15-labeled recombinant protein (NP_000057)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334645 Rabbit Polyclonal Anti-C8B Antibody
100 ul
$585.00
LY424942 Transient overexpression lysate of complement component 8, beta polypeptide (C8B) (as WB positive control) 100 ug
$665.00

Other products for "Complement factor 8 beta or NM_000066"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219942
Predicted MW 67 kDa
Protein Sequence
Protein Sequence
>RC219942 protein sequence
Red=Cloning site Green=Tags(s)

MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW
SSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLC
NGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRF
RKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIR
RTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL
GGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMK
QALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGR
RKTRQRQCNNPPPQNGGSPCSGPASETLDCS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000057
RefSeq Size 2178
RefSeq ORF 1773
Synonyms C82
Locus ID 732
UniProt ID P07358
Cytogenetics 1p32.2
Summary This gene encodes one of the three subunits of the complement component 8 (C8) protein. C8 is composed of equimolar amounts of alpha, beta and gamma subunits, which are encoded by three separate genes. C8 is one component of the membrane attack complex, which mediates cell lysis, and it initiates membrane penetration of the complex. This protein mediates the interaction of C8 with the C5b-7 membrane attack complex precursor. In humans deficiency of this protein is associated with increased risk of meningococcal infections. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jun 2013
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Complement factor 8 beta" proteins (3)
SKU Description Size Price
LC424942 Lyophilized C8B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424942 Transient overexpression lysate of complement component 8, beta polypeptide (C8B) (as WB positive control) 100 ug
$665.00
TP319942 Recombinant protein of human complement component 8, beta polypeptide (C8B), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products