UNC119B (NM_001080533) Human Mass Spec Standard

SKU
PH319902
UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219902]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC219902 representing NM_001080533
Red=Cloning site Green=Tags(s)

MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRP
EHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFV
RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQL
SEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001074002
RefSeq Size 4811
RefSeq ORF 753
Synonyms POC7B
Locus ID 84747
UniProt ID A6NIH7
Cytogenetics 12q24.31
Summary Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated NPHP3 and plays a key role in localization of NPHP3 to the primary cilium membrane. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:UNC119B (NM_001080533) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421088 UNC119B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421088 Transient overexpression lysate of unc-119 homolog B (C. elegans) (UNC119B) 100 ug
$436.00
TP319902 Recombinant protein of human unc-119 homolog B (C. elegans) (UNC119B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.