UNC119B (NM_001080533) Human Tagged ORF Clone

SKU
RC219902
UNC119B (Myc-DDK-tagged)-Human unc-119 homolog B (C. elegans) (UNC119B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UNC119B
Synonyms POC7B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219902 representing NM_001080533
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGGGTCTAACCCGAAGGCTGCGGCCGCGGCGTCGGCGGCTGGGCCCGGGGGGCTGGTGGCTGGCA
AGGAGGAGAAGAAGAAGGCGGGCGGCGGCGTCCTGAACCGCCTGAAGGCGCGGCGGCAGGCGCCCCACCA
CGCGGCCGACGACGGCGTCGGGGCAGCGGTCACGGAGCAGGAGCTGCTGGCGCTGGACACCATCCGGCCC
GAGCACGTCCTGCGCCTCAGCCGGGTCACCGAGAATTATTTATGTAAACCCGAAGACAACATCTACAGTA
TTGATTTCACCCGCTTCAAAATTCGAGATTTGGAGACAGGGACAGTACTTTTTGAGATTGCCAAACCTTG
CGTTTCAGACCAGGAGGAGGATGAGGAGGAGGGAGGTGGAGACGTGGACATCAGCGCAGGACGTTTTGTC
CGCTATCAGTTCACACCGGCATTTCTCCGCCTCCGGACAGTCGGGGCTACGGTGGAGTTCACAGTGGGAG
ACAAACCTGTTTCAAACTTCCGGATGATCGAACGGCACTATTTCCGGGAACACTTGCTGAAAAACTTTGA
CTTTGATTTTGGCTTCTGCATCCCCAGCAGTAGGAACACTTGTGAACATATCTATGAGTTTCCCCAGCTT
TCGGAGGATGTCATTCGTCTAATGATTGAAAATCCTTACGAGACCCGCTCTGACAGCTTCTACTTTGTTG
ACAACAAGCTGATAATGCACAACAAGGCTGATTATGCCTATAATGGAGGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219902 representing NM_001080533
Red=Cloning site Green=Tags(s)

MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRP
EHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFV
RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQL
SEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001080533
ORF Size 753 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001080533.3
RefSeq Size 4811 bp
RefSeq ORF 756 bp
Locus ID 84747
UniProt ID A6NIH7
Cytogenetics 12q24.31
MW 28 kDa
Summary Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated NPHP3 and plays a key role in localization of NPHP3 to the primary cilium membrane. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:UNC119B (NM_001080533) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219902L3 Lenti ORF clone of Human unc-119 homolog B (C. elegans) (UNC119B), Myc-DDK-tagged 10 ug
$600.00
RC219902L4 Lenti ORF clone of Human unc-119 homolog B (C. elegans) (UNC119B), mGFP tagged 10 ug
$600.00
RG219902 UNC119B (tGFP-tagged) - Human unc-119 homolog B (C. elegans) (UNC119B) 10 ug
$500.00
SC315704 UNC119B (untagged)-Human unc-119 homolog B (C. elegans) (UNC119B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.