CD30 (TNFRSF8) (NM_001243) Human Mass Spec Standard

SKU
PH319819
TNFRSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001234)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219819]
Predicted MW 63.75 kDa
Protein Sequence
Protein Sequence
>RC219819 representing NM_001243
Red=Cloning site Green=Tags(s)

MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE
PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFP
GTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTR
APDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRT
CECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP
TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASP
AGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHY
PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001234
RefSeq Size 3686
RefSeq ORF 1785
Synonyms CD30; D1S166E; Ki-1
Locus ID 943
UniProt ID P28908
Cytogenetics 1p36.22
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Write Your Own Review
You're reviewing:CD30 (TNFRSF8) (NM_001243) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420050 TNFRSF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420050 Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1 100 ug
$665.00
TP319819 Recombinant protein of human tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, 20 µg 20 ug
$737.00
TP710113 Recombinant protein of human tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, residues 19-379aa, with C-terminal DDK tag,expressed in sf9 cells 20 ug
$515.00
TP721319 Human CD30/TNFRSF8 Protein (C-His) 25 ug
$300.00
TP721320 Human CD30/TNFRSF8 Protein (C-His-Avi) 25 ug
$300.00
TP721321 Biotinylated Human CD30/TNFRSF8 Protein (C-His-Avi) 25 ug
$430.00
TP721322 PE Conjugated Human CD30/TNFRSF8 Protein (C-His) 25 ug
$430.00
TP721323 APC Conjugated Human CD30/TNFRSF8 Protein (C-His) 25 ug
$430.00
TP724016 Human CD30 Protein, His tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.