TIA1 (NM_022173) Human Mass Spec Standard

SKU
PH319386
TIA1 MS Standard C13 and N15-labeled recombinant protein (NP_071505)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219386]
Predicted MW 42.8 kDa
Protein Sequence
Protein Sequence
>RC219386 representing NM_022173
Red=Cloning site Green=Tags(s)

MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRK
IMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKD
MATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS
PSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVK
CYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSS
APWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071505
RefSeq Size 2390
RefSeq ORF 1158
Synonyms ALS26; TIA-1; WDM
Locus ID 7072
UniProt ID P31483
Cytogenetics 2p13.3
Summary The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene. [provided by RefSeq, May 2017]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:TIA1 (NM_022173) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411728 TIA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411728 Transient overexpression lysate of TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2 100 ug
$436.00
TP319386 Recombinant protein of human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, 20 µg 20 ug
$737.00
TP762405 Purified recombinant protein of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, Val279-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.