TIA1 (NM_022173) Human Tagged ORF Clone

SKU
RC219386
TIA1 (Myc-DDK-tagged)-Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIA1
Synonyms ALS26; TIA-1; WDM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219386 representing NM_022173
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTC
TGCAACTCTTTAGCCAGATTGGACCTTGTAAAAACTGCAAAATGATTATGGATACAGCTGGAAATGATCC
CTATTGTTTTGTGGAGTTTCATGAGCATCGTCATGCAGCTGCAGCATTAGCTGCTATGAATGGACGGAAG
ATAATGGGTAAGGAAGTCAAAGTGAATTGGGCAACAACCCCTAGCAGTCAAAAGAAAGATACAAGCAGTA
GTACCGTTGTCAGCACACAGCGTTCACAAGATCATTTCCATGTCTTTGTTGGTGATCTCAGCCCAGAAAT
TACAACTGAAGATATAAAAGCTGCTTTTGCACCATTTGGAAGAATATCAGATGCCCGAGTGGTAAAAGAC
ATGGCAACAGGAAAGTCTAAGGGATATGGCTTTGTCTCCTTTTTCAACAAATGGGATGCTGAAAACGCCA
TTCAACAGATGGGTGGCCAGTGGCTTGGTGGAAGACAAATCAGAACTAACTGGGCAACCCGAAAGCCTCC
CGCTCCAAAGAGTACATATGAGTCAAATACCAAACAGCTATCATATGATGAGGTTGTAAATCAGTCTAGT
CCAAGCAACTGTACTGTATACTGTGGAGGTGTTACTTCTGGGCTAACAGAACAACTAATGCGTCAGACTT
TTTCACCATTTGGACAAATAATGGAAATTCGAGTCTTTCCAGATAAAGGATATTCATTTGTTCGGTTCAA
TTCCCATGAAAGTGCAGCACATGCAATTGTTTCTGTTAATGGTACTACCATTGAAGGTCATGTTGTGAAA
TGCTATTGGGGCAAAGAAACTCTTGATATGATAAATCCCGTGCAACAGCAGAATCAAATTGGATATCCCC
AACCTTATGGCCAGTGGGGCCAGTGGTATGGAAATGCACAACAAATTGGCCAGTATATGCCTAATGGTTG
GCAAGTTCCTGCATATGGAATGTATGGCCAGGCATGGAACCAGCAAGGATTTAATCAGACACAGTCTTCT
GCACCATGGATGGGACCAAATTATGGAGTGCAACCGCCTCAAGGGCAAAATGGCAGCATGTTGCCCAATC
AGCCTTCTGGGTATCGAGTGGCAGGGTATGAAACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219386 representing NM_022173
Red=Cloning site Green=Tags(s)

MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRK
IMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKD
MATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS
PSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVK
CYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSS
APWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022173
ORF Size 1158 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022173.4
RefSeq Size 2390 bp
RefSeq ORF 1161 bp
Locus ID 7072
UniProt ID P31483
Cytogenetics 2p13.3
Domains RRM, RRM_1
Protein Families Druggable Genome
MW 42.8 kDa
Summary The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene. [provided by RefSeq, May 2017]
Write Your Own Review
You're reviewing:TIA1 (NM_022173) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219386L1 Lenti ORF clone of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, Myc-DDK-tagged 10 ug
$986.00
RC219386L2 Lenti ORF clone of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, mGFP tagged 10 ug
$986.00
RC219386L3 Lenti ORF clone of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, Myc-DDK-tagged 10 ug
$986.00
RC219386L4 Lenti ORF clone of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, mGFP tagged 10 ug
$986.00
RG219386 TIA1 (tGFP-tagged) - Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2 10 ug
$886.00
SC313245 TIA1 (untagged)-Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.