OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC46 (CEP112) (NM_001037325) Human Mass Spec Standard

Be the first to review this product
SKU
PH319337
CCDC46 MS Standard C13 and N15-labeled recombinant protein (NP_001032402)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336010 Rabbit Polyclonal Anti-CEP112 Antibody
100 ul
$585.00
LY421947 Transient overexpression lysate of coiled-coil domain containing 46 (CCDC46), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CCDC46 or NM_001037325"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219337
Predicted MW 24.4 kDa
Protein Sequence
Protein Sequence
>RC219337 representing NM_001037325
Red=Cloning site Green=Tags(s)

MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKL
AKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRC
AEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGR
R

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032402
RefSeq Size 1258
RefSeq ORF 633
Synonyms CCDC46; MACOCO; SPGF44
Locus ID 201134
UniProt ID Q8N8E3
Cytogenetics 17q24.1
Summary This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC46" proteins (3)
SKU Description Size Price
LC421947 Lyophilized CEP112 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421947 Transient overexpression lysate of coiled-coil domain containing 46 (CCDC46), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP319337 Recombinant protein of human coiled-coil domain containing 46 (CCDC46), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products