HFE (NM_139006) Human Mass Spec Standard

SKU
PH319316
HFE MS Standard C13 and N15-labeled recombinant protein (NP_620575)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219316]
Predicted MW 36.2 kDa
Protein Sequence
Protein Sequence
>RC219316 representing NM_139006
Red=Cloning site Green=Tags(s)

MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP
RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY
DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVTTLR
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLI
VIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620575
RefSeq Size 1045
RefSeq ORF 1002
Synonyms HFE1; HH; HLA-H; MVCD7; TFQTL2
Locus ID 3077
UniProt ID Q30201
Cytogenetics 6p22.2
Summary The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:HFE (NM_139006) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317447 HFE MS Standard C13 and N15-labeled recombinant protein (NP_000401) 10 ug
$3,255.00
PH319465 HFE MS Standard C13 and N15-labeled recombinant protein (NP_620578) 10 ug
$3,255.00
LC408433 HFE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408436 HFE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424725 HFE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408433 Transient overexpression lysate of hemochromatosis (HFE), transcript variant 6 100 ug
$436.00
LY408436 Transient overexpression lysate of hemochromatosis (HFE), transcript variant 9 100 ug
$436.00
LY424725 Transient overexpression lysate of hemochromatosis (HFE), transcript variant 1 100 ug
$436.00
TP317447 Recombinant protein of human hemochromatosis (HFE), transcript variant 1, 20 µg 20 ug
$867.00
TP319316 Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 6, 20 µg 20 ug
$867.00
TP319465 Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 9, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.