Epac1 (RAPGEF3) (NM_001098532) Human Mass Spec Standard

SKU
PH319138
RAPGEF3 MS Standard C13 and N15-labeled recombinant protein (NP_001092002)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219138]
Predicted MW 99.2 kDa
Protein Sequence
Protein Sequence
>RC219138 representing NM_001098532
Red=Cloning site Green=Tags(s)

MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATC
PNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFY
RFPGPEPEPVGTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEELLHIKAVAHLSNS
VKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRA
ATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGT
PEKILELLLEAMGPDSSAHDPTETFLSDFLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKR
QQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMK
ARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLV
KVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTD
HDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLA
AHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVI
PFMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARI
STCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092002
RefSeq Size 3425
RefSeq ORF 2643
Synonyms bcm910; CAMP-GEFI; EPAC; EPAC1; HSU79275
Locus ID 10411
UniProt ID O95398
Cytogenetics 12q13.11
Summary Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which it activates the PI3K gamma complex and which is involved in angiogenesis. Plays a role in the modulation of the cAMP-induced dynamic control of endothelial barrier function through a pathway that is independent on Rho-mediated signaling. Required for the actin rearrangement at cell-cell junctions, such as stress fibers and junctional actin.[UniProtKB/Swiss-Prot Function]
Protein Pathways Leukocyte transendothelial migration, Long-term potentiation
Write Your Own Review
You're reviewing:Epac1 (RAPGEF3) (NM_001098532) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304518 RAPGEF3 MS Standard C13 and N15-labeled recombinant protein (NP_006096) 10 ug
$3,255.00
LC401841 RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420629 RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401841 Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2 100 ug
$436.00
LY420629 Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3 100 ug
$665.00
TP304518 Recombinant protein of human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2, 20 µg 20 ug
$737.00
TP319138 Recombinant protein of human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.