ACSL5 (NM_203380) Human Mass Spec Standard

SKU
PH318932
ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976314)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218932]
Predicted MW 82.3 kDa
Protein Sequence
Protein Sequence
>RC218932 protein sequence
Red=Cloning site Green=Tags(s)

MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPT
PALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG
LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYT
YSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGE
KSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYE
PTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQN
EAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAA
MGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGY
LKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVH
GESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLH
PEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976314
RefSeq Size 3399
RefSeq ORF 2217
Synonyms ACS2; ACS5; FACL5
Locus ID 51703
UniProt ID Q9ULC5
Cytogenetics 10q25.2
Summary The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Protein Pathways Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway
Write Your Own Review
You're reviewing:ACSL5 (NM_203380) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313380 ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976313) 10 ug
$3,255.00
LC404321 ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404322 ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414108 ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404321 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2 100 ug
$665.00
LY404322 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3 100 ug
$665.00
LY414108 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 1 100 ug
$436.00
TP313380 Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2, 20 µg 20 ug
$737.00
TP318932 Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.