ACSL5 (NM_203379) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213380] |
Predicted MW | 82.3 kDa |
Protein Sequence |
Protein Sequence
>RC213380 protein sequence
Red=Cloning site Green=Tags(s) MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPT PALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYT YSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGE KSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYE PTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQN EAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAA MGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGY LKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVH GESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLH PEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_976313 |
RefSeq Size | 3233 |
RefSeq ORF | 2217 |
Synonyms | ACS2; ACS5; FACL5 |
Locus ID | 51703 |
UniProt ID | Q9ULC5 |
Cytogenetics | 10q25.2 |
Summary | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH318932 | ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976314) | 10 ug |
$3,255.00
|
|
LC404321 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC404322 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC414108 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404321 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2 | 100 ug |
$665.00
|
|
LY404322 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3 | 100 ug |
$665.00
|
|
LY414108 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 1 | 100 ug |
$436.00
|
|
TP313380 | Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP318932 | Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.