Bestrophin 3 (BEST3) (NM_152439) Human Mass Spec Standard

SKU
PH318436
BEST3 MS Standard C13 and N15-labeled recombinant protein (NP_689652)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218436]
Predicted MW 50.8 kDa
Protein Sequence
Protein Sequence
>RC218436 representing NM_152439
Red=Cloning site Green=Tags(s)

MTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI
PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAAD
YCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDSSMF
LPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSVRTS
PIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPGGPS
PQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGINIV
AGSRVSSDMLYLMENLDTKETDIIELNKETEESPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689652
RefSeq Size 2898
RefSeq ORF 1365
Synonyms VMD2L3
Locus ID 144453
UniProt ID Q8N1M1
Cytogenetics 12q15
Summary BEST3 belongs to the bestrophin family of anion channels, which includes BEST1 (MIM 607854), the gene mutant in vitelliform macular dystrophy (VMD; MIM 153700), and 2 other BEST1-like genes, BEST2 (MIM 607335) and BEST4 (MIM 607336). Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. Each of the 4 bestrophin genes has a unique 3-prime end of variable length (Stohr et al., 2002 [PubMed 12032738]; Tsunenari et al., 2003 [PubMed 12907679]).[supplied by OMIM, Mar 2008]
Protein Families Ion Channels: Other, Transmembrane
Write Your Own Review
You're reviewing:Bestrophin 3 (BEST3) (NM_152439) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407540 BEST3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409969 BEST3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407540 Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 2 100 ug
$665.00
LY409969 Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 1 100 ug
$665.00
TP318436 Recombinant protein of human bestrophin 3 (BEST3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.