DYNLT1 (NM_006519) Human Mass Spec Standard

SKU PH318331

DYNLT1 MS Standard C13 and N15-labeled recombinant protein (NP_006510)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC218331]
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC218331 representing NM_006519; Red=Cloning site Green=Tags(s); ; MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM; QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006510
• RefSeq Size: 713
• RefSeq ORF: 339
• Synonyms: CW-1; TCTEL1; tctex-1; TCTEX1
• Locus ID: 6993
• UniProt ID: P63172
• Cytogenetics: 6q25.3
• Summary: This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]