CD14 (NM_001040021) Human Mass Spec Standard

SKU
PH318181
CD14 MS Standard C13 and N15-labeled recombinant protein (NP_001035110)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218181]
Predicted MW 40.1 kDa
Protein Sequence
Protein Sequence
>RC218181 protein sequence
Red=Cloning site Green=Tags(s)

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL
KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT
GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER
GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS
LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP
ACARSTLSVGVSGTLVLLQGARGFA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035110
RefSeq Size 1561
RefSeq ORF 1125
Locus ID 929
UniProt ID P08571
Cytogenetics 5q31.3
Summary The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2020]
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Hematopoietic cell lineage, MAPK signaling pathway, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:CD14 (NM_001040021) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303819 CD14 MS Standard C13 and N15-labeled recombinant protein (NP_000582) 10 ug
$3,255.00
LC421877 CD14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424624 CD14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421877 Transient overexpression lysate of CD14 molecule (CD14), transcript variant 2 100 ug
$436.00
LY424624 Transient overexpression lysate of CD14 molecule (CD14), transcript variant 1 100 ug
$436.00
TP303819 Recombinant protein of human CD14 molecule (CD14), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318181 Recombinant protein of human CD14 molecule (CD14), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP700277 Purified recombinant protein of human CD14 molecule (CD14), transcript variant 1, with C-terminal Fc tag, expressed in human cells, 20 µg 20 ug
$867.00
TP723883 Purified recombinant protein of Human CD14 molecule (CD14), transcript variant 1 10 ug
$255.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.