PTP epsilon (PTPRE) (NM_130435) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217899] |
Predicted MW | 74.4 kDa |
Protein Sequence |
Protein Sequence
>RC217899 representing NM_130435
Red=Cloning site Green=Tags(s) MSNRSSFSRLTWFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRS ADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGY KEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVV LVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAG VGRTGTFIVIDAMMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLE KHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEY TDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTH GEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQ QQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQD FIDIFSDYANFK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_569119 |
RefSeq Size | 5002 |
RefSeq ORF | 1926 |
Synonyms | HPTPE; PTPE; R-PTP-EPSILON |
Locus ID | 5791 |
UniProt ID | P23469 |
Cytogenetics | 10q26.2 |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Several alternatively spliced transcript variants of this gene have been reported, at least two of which encode a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokine-induced SATA signaling, as well as the activation of voltage-gated K+ channels. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307950 | PTPRE MS Standard C13 and N15-labeled recombinant protein (NP_006495) | 10 ug |
$3,255.00
|
|
LC401950 | PTPRE HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408966 | PTPRE HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY401950 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 1 | 100 ug |
$436.00
|
|
LY408966 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 2 | 100 ug |
$665.00
|
|
TP307950 | Recombinant protein of human protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP317899 | Recombinant protein of human protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.