PTP epsilon (PTPRE) (NM_006504) Human Mass Spec Standard

SKU
PH307950
PTPRE MS Standard C13 and N15-labeled recombinant protein (NP_006495)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207950]
Predicted MW 80.6 kDa
Protein Sequence
Protein Sequence
>RC207950 protein sequence
Red=Cloning site Green=Tags(s)

MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFR
FRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFN
SLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGP
KQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQ
PQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDA
MMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTH
FDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGY
RQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTL
SEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHC
SAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006495
RefSeq Size 5392
RefSeq ORF 2100
Synonyms HPTPE; PTPE; R-PTP-EPSILON
Locus ID 5791
UniProt ID P23469
Cytogenetics 10q26.2
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Several alternatively spliced transcript variants of this gene have been reported, at least two of which encode a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokine-induced SATA signaling, as well as the activation of voltage-gated K+ channels. [provided by RefSeq, Oct 2015]
Protein Families Druggable Genome, Phosphatase, Transmembrane
Write Your Own Review
You're reviewing:PTP epsilon (PTPRE) (NM_006504) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317899 PTPRE MS Standard C13 and N15-labeled recombinant protein (NP_569119) 10 ug
$3,255.00
LC401950 PTPRE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408966 PTPRE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401950 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 1 100 ug
$436.00
LY408966 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 2 100 ug
$665.00
TP307950 Recombinant protein of human protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 1, 20 µg 20 ug
$867.00
TP317899 Recombinant protein of human protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.