ING1 (NM_198219) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217763] |
Predicted MW | 31.9 kDa |
Protein Sequence |
Protein Sequence
>RC217763 protein sequence
Red=Cloning site Green=Tags(s) MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRM LHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA QADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_937862 |
RefSeq Size | 2887 |
RefSeq ORF | 837 |
Synonyms | p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a |
Locus ID | 3621 |
UniProt ID | Q9UK53 |
Cytogenetics | 13q34 |
Summary | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403677 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404951 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417242 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429254 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC430724 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403677 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 2 | 100 ug |
$436.00
|
|
LY404951 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 | 100 ug |
$436.00
|
|
LY417242 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 4 | 100 ug |
$665.00
|
|
LY430724 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 | 100 ug |
$436.00
|
|
TP317763 | Recombinant protein of human inhibitor of growth family, member 1 (ING1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760507 | Purified recombinant protein of Human inhibitor of growth family, member 1 (ING1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.