ING1 (NM_198219) Human Tagged ORF Clone

SKU
RC217763
ING1 (Myc-DDK-tagged)-Human inhibitor of growth family, member 1 (ING1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ING1
Synonyms p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217763 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGAGTCCTGCCAACGGGGAGCAGCTCCACCTGGTGAACTATGTGGAGGACTACCTGGACTCCATCG
AGTCCCTGCCTTTCGACTTGCAGAGAAATGTCTCGCTGATGCGGGAGATCGACGCGAAATACCAAGAGAT
CCTGAAGGAGCTAGACGAGTGCTACGAGCGCTTCAGTCGCGAGACAGACGGGGCGCAGAAGCGGCGGATG
CTGCACTGTGTGCAGCGCGCGCTGATCCGCAGCCAGGAGCTGGGCGACGAGAAGATCCAGATCGTGAGCC
AGATGGTGGAGCTGGTGGAGAACCGCACGCGGCAGGTGGACAGCCACGTGGAGCTGTTCGAGGCGCAGCA
GGAGCTGGGCGACACAGCGGGCAACAGCGGCAAGGCTGGCGCGGACAGGCCCAAAGGCGAGGCGGCAGCG
CAGGCTGACAAGCCCAACAGCAAGCGCTCACGGCGGCAGCGCAACAACGAGAACCGTGAGAACGCGTCCA
GCAACCACGACCACGACGACGGCGCCTCGGGCACACCCAAGGAGAAGAAGGCCAAGACCTCCAAGAAGAA
GAAGCGCTCCAAGGCCAAGGCGGAGCGAGAGGCGTCCCCTGCCGACCTCCCCATCGACCCCAACGAACCC
ACGTACTGTCTGTGCAACCAGGTCTCCTATGGGGAGATGATCGGCTGCGACAACGACGAGTGCCCCATCG
AGTGGTTCCACTTCTCGTGCGTGGGGCTCAATCATAAACCCAAGGGCAAGTGGTACTGTCCCAAGTGCCG
GGGGGAGAACGAGAAGACCATGGACAAAGCCCTGGAGAAATCCAAAAAAGAGAGGGCTTACAACAGG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217763 protein sequence
Red=Cloning site Green=Tags(s)

MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRM
LHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
QADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP
TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_198219
ORF Size 837 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198219.3
RefSeq Size 2887 bp
RefSeq ORF 840 bp
Locus ID 3621
UniProt ID Q9UK53
Cytogenetics 13q34
Protein Families Druggable Genome, Transcription Factors
MW 31.9 kDa
Summary This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ING1 (NM_198219) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217763L1 Lenti ORF clone of Human inhibitor of growth family, member 1 (ING1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC217763L2 Lenti ORF clone of Human inhibitor of growth family, member 1 (ING1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC217763L3 Lenti ORF clone of Human inhibitor of growth family, member 1 (ING1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC217763L4 Lenti ORF clone of Human inhibitor of growth family, member 1 (ING1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG217763 ING1 (tGFP-tagged) - Human inhibitor of growth family, member 1 (ING1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124139 ING1 (untagged)-Human inhibitor of growth family, member 1 (ING1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.