OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WIPF1 (NM_003387) Human Mass Spec Standard

Be the first to review this product
SKU
PH317601
WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_003378)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383321 WIPF1 Rabbit polyclonal Antibody
100 ul
$410.00
LY401163 Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "WIPF1 or NM_003387"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217601
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC217601 representing NM_003387
Red=Cloning site Green=Tags(s)

MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG
GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP
FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHNRGSPPVPGGP
RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE
AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS
PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR
RERGAPPLPPIPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003378
RefSeq Size 4605
RefSeq ORF 1509
Synonyms PRPL-2; WAS2; WASPIP; WIP
Locus ID 7456
UniProt ID O43516
Cytogenetics 2q31.1
Summary This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WIPF1" proteins (7)
SKU Description Size Price
PH312019 WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001070737) 10 ug
$3,360.00
LC401163 Lyophilized WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421397 Lyophilized WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401163 Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY421397 Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP312019 Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2, 20 µg 20 ug
$867.00
TP317601 Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products