WIPF1 (NM_001077269) Human Mass Spec Standard

SKU
PH312019
WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001070737)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212019]
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC212019 representing NM_001077269
Red=Cloning site Green=Tags(s)

MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG
GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP
FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHNRGSPPVPGGP
RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE
AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS
PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR
RERGAPPLPPIPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070737
RefSeq Size 4664
RefSeq ORF 1509
Synonyms PRPL-2; WAS2; WASPIP; WIP
Locus ID 7456
UniProt ID O43516
Cytogenetics 2q31.1
Summary This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:WIPF1 (NM_001077269) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317601 WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_003378) 10 ug
$3,255.00
LC401163 WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421397 WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401163 Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 100 ug
$665.00
LY421397 Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2 100 ug
$665.00
TP312019 Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2, 20 µg 20 ug
$867.00
TP317601 Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.