PPM1H (NM_020700) Human Mass Spec Standard

SKU
PH317548
PPM1H MS Standard C13 and N15-labeled recombinant protein (NP_065751)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217548]
Predicted MW 56.3 kDa
Protein Sequence
Protein Sequence
>RC217548 representing NM_020700
Red=Cloning site Green=Tags(s)

MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE
TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE
GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA
SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK
LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY
RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD
LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS
NDRLGSGDDISVYVIPLIHGNKLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065751
RefSeq Size 6201
RefSeq ORF 1542
Synonyms ARHCL1; NERPP-2C; URCC2
Locus ID 57460
UniProt ID Q9ULR3
Cytogenetics 12q14.1-q14.2
Summary Dephosphorylates CDKN1B at 'Thr-187', thus removing a signal for proteasomal degradation.[UniProtKB/Swiss-Prot Function]
Protein Families Phosphatase
Write Your Own Review
You're reviewing:PPM1H (NM_020700) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412393 PPM1H HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412393 Transient overexpression lysate of protein phosphatase 1H (PP2C domain containing) (PPM1H) 100 ug
$665.00
TP317548 Recombinant protein of human protein phosphatase 1H (PP2C domain containing) (PPM1H), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.