OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPM1H (NM_020700) Human Mass Spec Standard

Be the first to review this product
SKU
PH317548
PPM1H MS Standard C13 and N15-labeled recombinant protein (NP_065751)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331287 Rabbit Polyclonal Anti-PPM1H Antibody
100 ul
$585.00
LY412393 Transient overexpression lysate of protein phosphatase 1H (PP2C domain containing) (PPM1H) (as WB positive control) 100 ug
$665.00

Other products for "PPM1H or NM_020700"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217548
Predicted MW 56.3 kDa
Protein Sequence
Protein Sequence
>RC217548 representing NM_020700
Red=Cloning site Green=Tags(s)

MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE
TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE
GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA
SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK
LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY
RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD
LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS
NDRLGSGDDISVYVIPLIHGNKLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065751
RefSeq Size 6201
RefSeq ORF 1542
Synonyms ARHCL1; NERPP-2C; URCC2
Locus ID 57460
UniProt ID Q9ULR3
Cytogenetics 12q14.1-q14.2
Summary Dephosphorylates CDKN1B at 'Thr-187', thus removing a signal for proteasomal degradation.UniProtKB/Swiss-Prot Function
Protein Families Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPM1H" proteins (3)
SKU Description Size Price
LC412393 Lyophilized PPM1H HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412393 Transient overexpression lysate of protein phosphatase 1H (PP2C domain containing) (PPM1H) (as WB positive control) 100 ug
$665.00
TP317548 Recombinant protein of human protein phosphatase 1H (PP2C domain containing) (PPM1H), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products