PPM1H Rabbit Polyclonal Antibody

SKU TA331287

Rabbit Polyclonal Anti-PPM1H Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPM1H antibody is: synthetic peptide directed towards the N-terminal region of Human PPM1H. Synthetic peptide located within the following region: TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: protein phosphatase, Mg2+/Mn2+ dependent 1H
• Database Link:
  NP_065751
  Q9ULR3
• Background: The function of this protein remains unknown.
• Synonyms: ARHCL1; NERPP-2C; URCC2
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Phosphatase