BAIAP2 (NM_017451) Human Mass Spec Standard

SKU
PH317285
BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059345)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217285]
Predicted MW 60.7 kDa
Protein Sequence
Protein Sequence
>RC217285 representing NM_017451
Red=Cloning site Green=Tags(s)

MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK
ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA
YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP
PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK
NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP
YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059345
RefSeq Size 2877
RefSeq ORF 1656
Synonyms BAP2; FLAF3; IRSP53; WAML
Locus ID 10458
UniProt ID Q9UQB8
Cytogenetics 17q25.3
Summary The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009]
Protein Families Druggable Genome
Protein Pathways Adherens junction, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:BAIAP2 (NM_017451) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304233 BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059344) 10 ug
$3,255.00
PH314570 BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_006331) 10 ug
$3,255.00
LC401909 BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC402587 BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413755 BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429535 BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401909 Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 3 100 ug
$436.00
LY402587 Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 1 100 ug
$436.00
LY413755 Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 100 ug
$665.00
LY429535 Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 100 ug
$436.00
TP304233 Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, 20 µg 20 ug
$737.00
TP314570 Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 3, 20 µg 20 ug
$737.00
TP317285 Purified recombinant protein of Homo sapiens BAI1-associated protein 2 (BAIAP2), transcript variant 2, 20 µg 20 ug
$737.00
TP710123 Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.