BAIAP2 (NM_006340) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC214570] |
Predicted MW | 57.3 kDa |
Protein Sequence |
Protein Sequence
>RC214570 representing NM_006340
Red=Cloning site Green=Tags(s) MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP YSVAVPAFSQGLDDYGARSMSSADVEVARF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006331 |
RefSeq Size | 2129 |
RefSeq ORF | 1560 |
Synonyms | BAP2; FLAF3; IRSP53; WAML |
Locus ID | 10458 |
UniProt ID | Q9UQB8 |
Cytogenetics | 17q25.3 |
Summary | The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Regulation of actin cytoskeleton |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304233 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059344) | 10 ug |
$3,255.00
|
|
PH317285 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059345) | 10 ug |
$3,255.00
|
|
LC401909 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC402587 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413755 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429535 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401909 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 3 | 100 ug |
$436.00
|
|
LY402587 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 1 | 100 ug |
$436.00
|
|
LY413755 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 | 100 ug |
$665.00
|
|
LY429535 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 | 100 ug |
$436.00
|
|
TP304233 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP314570 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP317285 | Purified recombinant protein of Homo sapiens BAI1-associated protein 2 (BAIAP2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP710123 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.