CAMK2G (NM_172173) Human Mass Spec Standard

SKU
PH317059
CAMK2G MS Standard C13 and N15-labeled recombinant protein (NP_751913)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217059]
Predicted MW 56.8 kDa
Protein Sequence
Protein Sequence
>RC217059 representing NM_172173
Red=Cloning site Green=Tags(s)

MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKH
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPE
NLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVG
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVAS
MMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLEPQTTVVHNAT
DGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDF
HKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLN
VHYHCSGAPAAPLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_751913
RefSeq Size 3665
RefSeq ORF 1512
Synonyms CAMK; CAMK-II; CAMKG; MRD59
Locus ID 818
UniProt ID Q13555
Cytogenetics 10q22.2
Summary The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.[provided by RefSeq, Mar 2011]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway
Write Your Own Review
You're reviewing:CAMK2G (NM_172173) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406780 CAMK2G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406781 CAMK2G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420064 CAMK2G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406780 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 2 100 ug
$436.00
LY406781 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 3 100 ug
$436.00
LY420064 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 4 100 ug
$665.00
TP317059 Recombinant protein of human calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761314 Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.