ABHD12 (NM_001042472) Human Mass Spec Standard

SKU
PH316963
ABHD12 MS Standard C13 and N15-labeled recombinant protein (NP_001035937)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216963]
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC216963 representing NM_001042472
Red=Cloning site Green=Tags(s)

MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWL
RLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGV
WHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD
SVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE
EAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP
ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035937
RefSeq Size 1983
RefSeq ORF 1194
Synonyms ABHD12A; BEM46L2; C20orf22; dJ965G21.2; hABHD12; PHARC
Locus ID 26090
UniProt ID Q8N2K0
Cytogenetics 20p11.21
Summary This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jan 2011]
Protein Families Protease, Transmembrane
Write Your Own Review
You're reviewing:ABHD12 (NM_001042472) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414447 ABHD12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420926 ABHD12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414447 Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 2 100 ug
$436.00
LY420926 Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 1 100 ug
$436.00
TP316963 Recombinant protein of human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.