TMEM97 (NM_014573) Human Mass Spec Standard

SKU
PH316927
TMEM97 MS Standard C13 and N15-labeled recombinant protein (NP_055388)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216927]
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC216927 protein sequence
Red=Cloning site Green=Tags(s)

MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL
FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER
LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055388
RefSeq Size 2585
RefSeq ORF 528
Synonyms MAC30
Locus ID 27346
UniProt ID Q5BJF2
Cytogenetics 17q11.2
Summary TMEM97 is a conserved integral membrane protein that plays a role in controlling cellular cholesterol levels (Bartz et al., 2009 [PubMed 19583955]).[supplied by OMIM, Aug 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM97 (NM_014573) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415192 TMEM97 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415192 Transient overexpression lysate of transmembrane protein 97 (TMEM97) 100 ug
$436.00
TP316927 Recombinant protein of human transmembrane protein 97 (TMEM97), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.