TMEM97 (NM_014573) Human Tagged ORF Clone

SKU
RC216927
TMEM97 (Myc-DDK-tagged)-Human transmembrane protein 97 (TMEM97)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol TMEM97
Synonyms MAC30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216927 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGCTCCGGCAACCAGGCGCTGCGTGGAGTGGCTGCTGGGCCTCTACTTCCTCAGCCACATCCCCA
TCACCCTGTTCATGGACCTGCAGGCGGTGCTGCCGCGCGAGCTCTACCCAGTCGAGTTTAGAAACCTGCT
GAAGTGGTATGCTAAGGAGTTCAAAGACCCACTGCTACAGGAGCCCCCAGCCTGGTTTAAGTCCTTTCTG
TTTTGCGAGCTTGTGTTTCAGCTGCCTTTCTTTCCCATTGCAACGTATGCCTTCCTCAAAGGAAGCTGCA
AGTGGATTCGAACTCCTGCAATCATCTACTCTGTTCACACCATGACAACCTTAATTCCGATACTCTCCAC
ATTTCTGTTTGAGGATTTCTCCAAAGCCAGTGGTTTCAAGGGACAAAGACCTGAGACTTTGCATGAACGG
TTAACCCTTGTGTCTGTCTATGCCCCCTACTTACTCATCCCATTCATACTTTTAATTTTCATGTTGCGGA
GCCCCTACTACAAGTATGAAGAGAAAAGAAAAAAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216927 protein sequence
Red=Cloning site Green=Tags(s)

MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL
FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER
LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014573
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014573.3
RefSeq Size 2585 bp
RefSeq ORF 531 bp
Locus ID 27346
UniProt ID Q5BJF2
Cytogenetics 17q11.2
Protein Families Transmembrane
MW 20.8 kDa
Summary TMEM97 is a conserved integral membrane protein that plays a role in controlling cellular cholesterol levels (Bartz et al., 2009 [PubMed 19583955]).[supplied by OMIM, Aug 2009]
Write Your Own Review
You're reviewing:TMEM97 (NM_014573) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216927L1 Lenti ORF clone of Human transmembrane protein 97 (TMEM97), Myc-DDK-tagged 10 ug
$600.00
RC216927L2 Lenti ORF clone of Human transmembrane protein 97 (TMEM97), mGFP tagged 10 ug
$600.00
RC216927L3 Lenti ORF clone of Human transmembrane protein 97 (TMEM97), Myc-DDK-tagged 10 ug
$600.00
RC216927L4 Lenti ORF clone of Human transmembrane protein 97 (TMEM97), mGFP tagged 10 ug
$600.00
RG216927 TMEM97 (tGFP-tagged) - Human transmembrane protein 97 (TMEM97) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC107367 TMEM97 (untagged)-Human transmembrane protein 97 (TMEM97) 10 ug
$150.00
SC317273 TMEM97 (untagged)-Human transmembrane protein 97 (TMEM97) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.