IL10 (NM_000572) Human Mass Spec Standard

SKU
PH316785
IL10 MS Standard C13 and N15-labeled recombinant protein (NP_000563)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216785]
Predicted MW 20.52 kDa
Protein Sequence
Protein Sequence
>RC216785 representing NM_000572
Red=Cloning site Green=Tags(s)

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESL
LEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVE
QVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000563
RefSeq Size 1629
RefSeq ORF 534
Synonyms CSIF; GVHDS; IL-10; IL10A; TGIF
Locus ID 3586
UniProt ID P22301
Cytogenetics 1q32.1
Summary The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. [provided by RefSeq, May 2020]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Allograft rejection, Asthma, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Systemic lupus erythematosus, T cell receptor signaling pathway
Write Your Own Review
You're reviewing:IL10 (NM_000572) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424633 IL10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424633 Transient overexpression lysate of interleukin 10 (IL10) 100 ug
$436.00
TP316785 Purified recombinant protein of Homo sapiens interleukin 10 (IL10), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723714 Purified recombinant protein of Human interleukin 10 (IL10) 10 ug
$440.00
TP723723 Purified recombinant protein of Human interleukin 10 (IL10) 10 ug
$475.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.