IL24 (NM_006850) Human Mass Spec Standard

SKU
PH316502
IL24 MS Standard C13 and N15-labeled recombinant protein (NP_006841)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216502]
Predicted MW 23.8 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC216502
Blue=ORF Red=Cloning site Green=Tag(s)

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKL
WEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFS
TLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

myc-FLAG tag

Recombinant protein using RC216502 also available, TP316502M
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006841
RefSeq Size 1976
RefSeq ORF 618
Synonyms C49A; FISP; IL10B; MDA7; MOB5; ST16
Locus ID 11009
UniProt ID Q13007
Cytogenetics 1q32.1
Summary This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Write Your Own Review
You're reviewing:IL24 (NM_006850) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416383 IL24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416383 Transient overexpression lysate of interleukin 24 (IL24), transcript variant 1 100 ug
$436.00
TP316502 Recombinant protein of human interleukin 24 (IL24), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.