RAB6B (NM_016577) Human Mass Spec Standard

SKU
PH316303
RAB6B MS Standard C13 and N15-labeled recombinant protein (NP_057661)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216303]
Predicted MW 23.3 kDa
Protein Sequence
Protein Sequence
>RC216303 representing NM_016577
Red=Cloning site Green=Tags(s)

MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA
GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE
GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057661
RefSeq Size 5561
RefSeq ORF 624
Locus ID 51560
UniProt ID Q9NRW1
Cytogenetics 3q22.1
Summary Seems to have a role in retrograde membrane traffic at the level of the Golgi complex. May function in retrograde transport in neuronal cells.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB6B (NM_016577) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413899 RAB6B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413899 Transient overexpression lysate of RAB6B, member RAS oncogene family (RAB6B) 100 ug
$436.00
TP316303 Recombinant protein of human RAB6B, member RAS oncogene family (RAB6B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.