RAB6B (NM_016577) Human Tagged ORF Clone

SKU
RC216303
RAB6B (Myc-DDK-tagged)-Human RAB6B, member RAS oncogene family (RAB6B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB6B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216303 representing NM_016577
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGCAGGGGGAGATTTTGGGAATCCACTGAGAAAATTCAAGTTGGTGTTCTTGGGGGAGCAGAGCG
TCGGGAAGACGTCTCTGATTACGAGGTTCATGTACGACAGCTTCGACAACACATACCAGGCAACCATTGG
GATTGACTTCTTGTCAAAAACCATGTACTTGGAGGACCGCACGGTGCGACTGCAGCTCTGGGACACAGCT
GGTCAGGAGAGGTTCCGCAGCCTGATCCCCAGCTACATCCGGGACTCCACGGTGGCTGTGGTGGTGTACG
ACATCACAAATCTCAACTCCTTCCAACAGACCTCTAAGTGGATCGACGACGTCAGGACAGAGAGGGGCAG
TGATGTTATCATCATGCTGGTGGGCAACAAGACGGACCTGGCTGATAAGAGGCAGATAACCATCGAGGAG
GGGGAGCAGCGCGCCAAAGAACTGAGCGTCATGTTCATTGAGACCAGTGCGAAGACTGGCTACAACGTGA
AGCAGCTTTTTCGACGTGTGGCGTCGGCTCTACCCGGAATGGAGAATGTCCAGGAGAAAAGCAAAGAAGG
GATGATTGACATCAAGCTGGACAAACCCCAGGAGCCCCCGGCCAGCGAGGGCGGCTGCTCCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216303 representing NM_016577
Red=Cloning site Green=Tags(s)

MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA
GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE
GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016577
ORF Size 624 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016577.4
RefSeq Size 5561 bp
RefSeq ORF 627 bp
Locus ID 51560
UniProt ID Q9NRW1
Cytogenetics 3q22.1
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 23.3 kDa
Summary Seems to have a role in retrograde membrane traffic at the level of the Golgi complex. May function in retrograde transport in neuronal cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RAB6B (NM_016577) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216303L3 Lenti ORF clone of Human RAB6B, member RAS oncogene family (RAB6B), Myc-DDK-tagged 10 ug
$600.00
RC216303L4 Lenti ORF clone of Human RAB6B, member RAS oncogene family (RAB6B), mGFP tagged 10 ug
$600.00
RG216303 RAB6B (tGFP-tagged) - Human RAB6B, member RAS oncogene family (RAB6B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114224 RAB6B (untagged)-Human RAB6B, member RAS oncogene family (RAB6B) 10 ug
$300.00
SC317310 RAB6B (untagged)-Human RAB6B, member RAS oncogene family (RAB6B) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.