BRN3A (POU4F1) (NM_006237) Human Mass Spec Standard

SKU
PH316284
POU4F1 MS Standard C13 and N15-labeled recombinant protein (NP_006228)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216284]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC216284 representing NM_006237
Red=Cloning site Green=Tags(s)

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ
GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG
GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM
PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI
KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF
NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006228
RefSeq Size 3824
RefSeq ORF 1257
Synonyms ATITHS; brn-3A; BRN3A; Oct-T1; RDC-1
Locus ID 5457
UniProt ID Q01851
Cytogenetics 13q31.1
Summary This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias. [provided by RefSeq, Mar 2012]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:BRN3A (POU4F1) (NM_006237) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416781 POU4F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416781 Transient overexpression lysate of POU class 4 homeobox 1 (POU4F1) 100 ug
$665.00
TP316284 Recombinant protein of human POU class 4 homeobox 1 (POU4F1), 20 µg 20 ug
$737.00
TP762410 Purified recombinant protein of Human Mass Spec Standard(BRN3A), with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.