OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BRN3A (POU4F1) (NM_006237) Human Mass Spec Standard

Be the first to review this product
SKU
PH316284
POU4F1 MS Standard C13 and N15-labeled recombinant protein (NP_006228)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416781 Transient overexpression lysate of POU class 4 homeobox 1 (POU4F1) (as WB positive control) 100 ug
$665.00

Other products for "BRN3A or NM_006237"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216284
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC216284 representing NM_006237
Red=Cloning site Green=Tags(s)

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ
GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG
GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM
PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI
KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF
NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006228
RefSeq Size 3824
RefSeq ORF 1257
Synonyms ATITHS; brn-3A; BRN3A; Oct-T1; RDC-1
Locus ID 5457
UniProt ID Q01851
Cytogenetics 13q31.1
Summary This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias. provided by RefSeq, Mar 2012
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BRN3A" proteins (4)
SKU Description Size Price
LC416781 Lyophilized POU4F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416781 Transient overexpression lysate of POU class 4 homeobox 1 (POU4F1) (as WB positive control) 100 ug
$665.00
TP316284 Recombinant protein of human POU class 4 homeobox 1 (POU4F1), 20 µg 20 ug
$737.00
TP762410 Purified recombinant protein of Human Mass Spec Standard（BRN3A）, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products