OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRRC2 (NM_024512) Human Mass Spec Standard

Be the first to review this product
SKU
PH316196
LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_078788)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365347 LRRC2 rabbit polyclonal antibody
100 ul
$310.00
LY411257 Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LRRC2 or NM_024512"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216196
Predicted MW 42.8 kDa
Protein Sequence
Protein Sequence
>RC216196 representing NM_024512
Red=Cloning site Green=Tags(s)

MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID
TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI
QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL
SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML
NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE
DLKERESVPSYTTKVSFSLQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078788
RefSeq Size 4860
RefSeq ORF 1113
Locus ID 79442
UniProt ID Q9BYS8
Cytogenetics 3p21.31
Summary This gene encodes a member of the leucine-rich repeat-containing family of proteins, which function in diverse biological pathways. This family member may possibly be a nuclear protein. Similarity to the RAS suppressor protein, as well as expression down-regulation observed in tumor cells, suggests that it may function as a tumor suppressor. The gene is located in the chromosome 3 common eliminated region 1 (C3CER1), a 1.4 Mb region that is commonly deleted in diverse tumors. A related pseudogene has been identified on chromosome 2. provided by RefSeq, Sep 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRRC2" proteins (7)
SKU Description Size Price
PH306380 LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_079026) 10 ug
$3,360.00
LC411101 Lyophilized LRRC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411257 Lyophilized LRRC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411101 Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY411257 Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306380 Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 2, 20 µg 20 ug
$867.00
TP316196 Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products