LRRC2 (NM_024750) Human Mass Spec Standard

SKU
PH306380
LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_079026)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206380]
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC206380 protein sequence
Red=Cloning site Green=Tags(s)

MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID
TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI
QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL
SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML
NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE
DLKERESVPSYTTKVSFSLQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079026
RefSeq Size 4909
RefSeq ORF 1113
Synonyms leucine-rich repeat-containing 2; leucine rich repeat containing 2
Locus ID 79442
UniProt ID Q9BYS8
Cytogenetics 3p21.31
Summary This gene encodes a member of the leucine-rich repeat-containing family of proteins, which function in diverse biological pathways. This family member may possibly be a nuclear protein. Similarity to the RAS suppressor protein, as well as expression down-regulation observed in tumor cells, suggests that it may function as a tumor suppressor. The gene is located in the chromosome 3 common eliminated region 1 (C3CER1), a 1.4 Mb region that is commonly deleted in diverse tumors. A related pseudogene has been identified on chromosome 2. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:LRRC2 (NM_024750) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316196 LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_078788) 10 ug
$3,255.00
LC411101 LRRC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411257 LRRC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411101 Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 2 100 ug
$436.00
LY411257 Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 1 100 ug
$436.00
TP306380 Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 2, 20 µg 20 ug
$867.00
TP316196 Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.