CRYBA2 (NM_005209) Human Mass Spec Standard

SKU
PH316085
CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_005200)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216085]
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC216085 protein sequence
Red=Cloning site Green=Tags(s)

MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFIL
EKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDV
GSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005200
RefSeq Size 709
RefSeq ORF 591
Synonyms crystallin, beta A2; eye lens structural protein
Locus ID 1412
UniProt ID P53672
Cytogenetics 2q35
Summary Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CRYBA2 (NM_005209) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302403 CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476435) 10 ug
$3,255.00
PH323668 CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476434) 10 ug
$3,255.00
LC409256 CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409257 CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417446 CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409256 Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 2 100 ug
$436.00
LY409257 Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 3 100 ug
$436.00
LY417446 Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 1 100 ug
$436.00
TP302403 Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 3, 20 µg 20 ug
$737.00
TP316085 Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 1, 20 µg 20 ug
$737.00
TP323668 Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.