CRYBA2 (NM_005209) Human Tagged ORF Clone

SKU
RC216085
CRYBA2 (Myc-DDK-tagged)-Human crystallin, beta A2 (CRYBA2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CRYBA2
Synonyms crystallin, beta A2; eye lens structural protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216085 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGCGCCCCCGCGCCGGGCCCGGCGCCCGCCAGCCTCACGCTCTGGGACGAGGAGGACTTCCAGG
GCCGTCGCTGTCGGCTGCTAAGCGACTGTGCGAACGTCTGCGAGCGCGGAGGCCTGCCCAGGGTGCGCTC
GGTCAAGGTGGAAAACGGCGTTTGGGTGGCCTTTGAGTACCCCGACTTCCAGGGACAGCAGTTCATTCTG
GAGAAGGGAGACTATCCTCGCTGGAGCGCCTGGAGTGGCAGCAGCAGCCACAACAGCAACCAGCTGCTGT
CCTTCCGGCCAGTGCTCTGCGCGAACCACAATGACAGCCGTGTGACACTGTTTGAGGGGGACAACTTCCA
AGGCTGCAAGTTTGACCTCGTTGATGACTACCCATCCCTGCCCTCCATGGGCTGGGCCAGCAAGGATGTG
GGTTCCCTCAAAGTCAGCTCCGGAGCGTGGGTGGCCTACCAGTACCCAGGCTACCGAGGCTACCAGTATG
TGTTGGAGCGGGACCGGCACAGCGGAGAGTTCTGTACTTACGGTGAGCTCGGCACACAGGCCCACACTGG
GCAGCTGCAGTCCATCCGGAGAGTCCAGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216085 protein sequence
Red=Cloning site Green=Tags(s)

MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFIL
EKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDV
GSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005209
ORF Size 591 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005209.1, NP_005200.1
RefSeq Size 709 bp
RefSeq ORF 593 bp
Locus ID 1412
Cytogenetics 2q35
MW 22.1 kDa
Summary Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CRYBA2 (NM_005209) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216085L3 Lenti ORF clone of Human crystallin, beta A2 (CRYBA2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC216085L4 Lenti ORF clone of Human crystallin, beta A2 (CRYBA2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG216085 CRYBA2 (tGFP-tagged) - Human crystallin, beta A2 (CRYBA2), transcript variant 1 10 ug
$500.00
SC303603 CRYBA2 (untagged)-Human crystallin, beta A2 (CRYBA2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.