CRYBA2 (NM_057093) Human Recombinant Protein

SKU
TP323668
Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223668 protein sequence
Red=Cloning site Green=Tags(s)

MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFIL
EKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDV
GSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_476434
Locus ID 1412
UniProt ID P53672
Cytogenetics 2q35
RefSeq Size 903
RefSeq ORF 591
Synonyms CTRCT42
Summary Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CRYBA2 (NM_057093) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302403 CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476435) 10 ug
$3,255.00
PH316085 CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_005200) 10 ug
$3,255.00
PH323668 CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476434) 10 ug
$3,255.00
LC409256 CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409257 CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417446 CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409256 Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 2 100 ug
$436.00
LY409257 Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 3 100 ug
$436.00
LY417446 Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 1 100 ug
$436.00
TP302403 Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 3, 20 µg 20 ug
$737.00
TP316085 Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.