MBNL3 (NM_018388) Human Mass Spec Standard

SKU
PH316043
MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216043]
Predicted MW 38.4 kDa
Protein Sequence
Protein Sequence
>RC216043 representing NM_018388
Red=Cloning site Green=Tags(s)

MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL
HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM
GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD
NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT
PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN
QLKF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060858
RefSeq Size 2701
RefSeq ORF 1062
Synonyms CHCR; MBLX; MBLX39; MBXL
Locus ID 55796
UniProt ID Q9NUK0
Cytogenetics Xq26.2
Summary This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009]
Write Your Own Review
You're reviewing:MBNL3 (NM_018388) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316093 MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) 10 ug
$3,255.00
LC408817 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413087 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432842 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432854 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408817 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 100 ug
$436.00
LY413087 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 100 ug
$436.00
LY432842 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 100 ug
$436.00
LY432854 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 100 ug
$436.00
TP316043 Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316093 Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329842 Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329854 Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.