Morg1 (WDR83) (NM_001099737) Human Mass Spec Standard

SKU
PH315520
WDR83 MS Standard C13 and N15-labeled recombinant protein (NP_001093207)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215520]
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC215520 protein sequence
Red=Cloning site Green=Tags(s)

MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV
LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS
RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS
LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV
QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001093207
RefSeq Size 1476
RefSeq ORF 945
Synonyms MORG1
Locus ID 84292
UniProt ID Q9BRX9
Cytogenetics 19p13.13
Summary This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:Morg1 (WDR83) (NM_001099737) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301323 WDR83 MS Standard C13 and N15-labeled recombinant protein (NP_115708) 10 ug
$3,255.00
LC403158 WDR83 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420510 WDR83 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403158 Transient overexpression lysate of WD repeat domain 83 (WDR83), transcript variant 2 100 ug
$436.00
LY420510 Transient overexpression lysate of WD repeat domain 83 (WDR83), transcript variant 1 100 ug
$436.00
TP301323 Recombinant protein of human mitogen-activated protein kinase organizer 1 (MORG1), transcript variant 2, 20 µg 20 ug
$867.00
TP315520 Purified recombinant protein of Homo sapiens mitogen-activated protein kinase organizer 1 (MORG1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.