Morg1 (WDR83) (NM_032332) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201323] |
Predicted MW | 34.3 kDa |
Protein Sequence |
Protein Sequence
>RC201323 protein sequence
Red=Cloning site Green=Tags(s) MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_115708 |
RefSeq Size | 1219 |
RefSeq ORF | 945 |
Synonyms | MORG1 |
Locus ID | 84292 |
UniProt ID | Q9BRX9 |
Cytogenetics | 19p13.13 |
Summary | This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH315520 | WDR83 MS Standard C13 and N15-labeled recombinant protein (NP_001093207) | 10 ug |
$3,255.00
|
|
LC403158 | WDR83 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420510 | WDR83 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403158 | Transient overexpression lysate of WD repeat domain 83 (WDR83), transcript variant 2 | 100 ug |
$436.00
|
|
LY420510 | Transient overexpression lysate of WD repeat domain 83 (WDR83), transcript variant 1 | 100 ug |
$436.00
|
|
TP301323 | Recombinant protein of human mitogen-activated protein kinase organizer 1 (MORG1), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP315520 | Purified recombinant protein of Homo sapiens mitogen-activated protein kinase organizer 1 (MORG1), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.