OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ITGB1BP2 (NM_012278) Human Mass Spec Standard

Be the first to review this product
SKU
PH315481
ITGB1BP2 MS Standard C13 and N15-labeled recombinant protein (NP_036410)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346462 Rabbit Polyclonal Anti-ITGB1BP2 Antibody
100 ul
$525.00
LY415846 Transient overexpression lysate of integrin beta 1 binding protein (melusin) 2 (ITGB1BP2) (as WB positive control) 100 ug
$436.00

Other products for "ITGB1BP2 or NM_012278"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215481
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC215481 representing NM_012278
Red=Cloning site Green=Tags(s)

MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLP
EAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLD
SLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDW
GKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSS
VFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036410
RefSeq Size 1235
RefSeq ORF 1041
Synonyms CHORDC3; ITGB1BP; MELUSIN; MSTP015
Locus ID 26548
UniProt ID Q9UKP3
Cytogenetics Xq13.1
Summary This gene encodes a protein with two cysteine and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and an acidic region at the C-terminus that can bind calcium. Two hybrid analysis showed that this protein interacts with the cytoplasmic domain of the beta 1 integrin subunit and is thought to act as a chaperone protein. Studies in the mouse ortholog of this gene indicate that absence of this gene in mouse results in failed cardiac hypertrophy in response to mechanical stress. Alternative splicing results in multiple transcript variants encoding different isoforms, including an isoform that lacks several domains, including one of the CHORD domains. provided by RefSeq, May 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ITGB1BP2" proteins (3)
SKU Description Size Price
LC415846 Lyophilized ITGB1BP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415846 Transient overexpression lysate of integrin beta 1 binding protein (melusin) 2 (ITGB1BP2) (as WB positive control) 100 ug
$436.00
TP315481 Recombinant protein of human integrin beta 1 binding protein (melusin) 2 (ITGB1BP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products