ITGB1BP2 Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ITGB1BP2 antibody: synthetic peptide directed towards the N terminal of human ITGB1BP2. Synthetic peptide located within the following region: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 38 kDa |
Gene Name | integrin subunit beta 1 binding protein 2 |
Database Link | |
Background | ITGB1BP2 may play a role during maturation and/or organization of muscles cells. |
Synonyms | CHORDC3; ITGB1BP; MELUSIN; MSTP015 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 86% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.