OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGPEP1 (NM_017712) Human Mass Spec Standard

Be the first to review this product
SKU
PH314837
PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331888 Rabbit Polyclonal Anti-PGPEP1 Antibody
100 ul
$585.00
LY413619 Transient overexpression lysate of pyroglutamyl-peptidase I (PGPEP1) (as WB positive control) 100 ug
$436.00

Other products for "PGPEP1 or NM_017712"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214837
Predicted MW 23 kDa
Protein Sequence
Protein Sequence
>RC214837 representing NM_017712
Red=Cloning site Green=Tags(s)

MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV
VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI
SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060182
RefSeq Size 2239
RefSeq ORF 627
Synonyms PAP-I; Pcp; PGI; PGP; PGP-I; PGPI
Locus ID 54858
UniProt ID Q9NXJ5
Cytogenetics 19p13.11
Summary The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. provided by RefSeq, Jul 2016
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PGPEP1" proteins (3)
SKU Description Size Price
LC413619 Lyophilized PGPEP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413619 Transient overexpression lysate of pyroglutamyl-peptidase I (PGPEP1) (as WB positive control) 100 ug
$436.00
TP314837 Recombinant protein of human pyroglutamyl-peptidase I (PGPEP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products