DUSP27 (DUPD1) (NM_001003892) Human Mass Spec Standard

SKU
PH314361
DUPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003892)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214361]
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC214361 representing NM_001003892
Red=Cloning site Green=Tags(s)

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
DGEEEDGREL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001003892
RefSeq Size 663
RefSeq ORF 660
Synonyms DUPD1; DUSP27; FMDSP
Locus ID 338599
UniProt ID Q68J44
Cytogenetics 10q22.2
Summary Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate.[UniProtKB/Swiss-Prot Function]
Protein Families Phosphatase
Write Your Own Review
You're reviewing:DUSP27 (DUPD1) (NM_001003892) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424030 DUPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424030 Transient overexpression lysate of dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1) 100 ug
$436.00
TP314361 Recombinant protein of human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.