OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP27 (DUPD1) (NM_001003892) Human Mass Spec Standard

Be the first to review this product
SKU
PH314361
DUPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003892)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502080 DUPD1 (DUSP27) mouse monoclonal antibody, clone OTI7E4 (formerly 7E4) 100 ul
$447.00
LY424030 Transient overexpression lysate of dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1) (as WB positive control) 100 ug
$436.00

Other products for "DUSP27 or NM_001003892"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214361
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC214361 representing NM_001003892
Red=Cloning site Green=Tags(s)

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
DGEEEDGREL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001003892
RefSeq Size 663
RefSeq ORF 660
Synonyms DUPD1; DUSP27; FMDSP
Locus ID 338599
UniProt ID Q68J44
Cytogenetics 10q22.2
Summary Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate.UniProtKB/Swiss-Prot Function
Protein Families Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP27" proteins (3)
SKU Description Size Price
LC424030 Lyophilized DUPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424030 Transient overexpression lysate of dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1) (as WB positive control) 100 ug
$436.00
TP314361 Recombinant protein of human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products