DUSP27 (DUPD1) (NM_001003892) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC214361
DUPD1 (Myc-DDK-tagged)-Human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1)
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP27
Synonyms DUPD1; DUSP27; FMDSP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214361 representing NM_001003892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACATCTGGAGAAGTGAAGACAAGCCTCAAGAATGCCTACTCATCTGCCAAGAGGCTGTCGCCGAAGA
TGGAGGAGGAAGGGGAGGAGGAGGACTACTGCACCCCTGGAGCCTTTGAGCTGGAGCGGCTCTTCTGGAA
GGGCAGTCCCCAGTACACCCACGTCAACGAGGTCTGGCCCAAGCTCTACATTGGCGATGAGGCGACGGCG
CTGGACCGCTATAGGCTGCAGAAGGCGGGGTTCACGCACGTGCTGAACGCGGCCCACGGCCGCTGGAACG
TGGACACTGGGCCCGACTACTACCGCGACATGGACATCCAGTACCACGGCGTGGAGGCCGACGACCTGCC
CACCTTCGACCTCAGTGTCTTCTTCTACCCGGCGGCAGCCTTCATCGACAGAGCGCTAAGCGACGACCAC
AGTAAGATCCTGGTTCACTGCGTCATGGGCCGCAGCCGGTCAGCCACCCTGGTCCTGGCCTACCTGATGA
TCCACAAGGACATGACCCTGGTGGACGCCATCCAGCAAGTGGCCAAGAACCGCTGCGTCCTCCCGAACCG
GGGCTTTTTGAAGCAGCTCCGGGAGCTGGACAAGCAGCTGGTGCAGCAGAGGCGACGGTCCCAGCGCCAG
GACGGTGAGGAGGAGGATGGCAGGGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214361 representing NM_001003892
Red=Cloning site Green=Tags(s)

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
DGEEEDGREL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001003892
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001003892.2
RefSeq Size 663 bp
RefSeq ORF 663 bp
Locus ID 338599
UniProt ID Q68J44
Cytogenetics 10q22.2
Protein Families Phosphatase
MW 25.2 kDa
Summary Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate.[UniProtKB/Swiss-Prot Function]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC214361L3 Lenti ORF clone of Human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1), Myc-DDK-tagged 10 ug
$600.00
RC214361L4 Lenti ORF clone of Human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1), mGFP tagged 10 ug
$600.00
RG214361 DUPD1 (tGFP-tagged) - Human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127868 DUPD1 (untagged)-Human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.