VAPA (NM_003574) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC214308] |
Predicted MW | 32.4 kDa |
Protein Sequence |
Protein Sequence
>RC214308 representing NM_003574
Red=Cloning site Green=Tags(s) MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLG ITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSV SLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVI AAIFIGFFLGKFIL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003565 |
RefSeq Size | 6994 |
RefSeq ORF | 882 |
Synonyms | hVAP-33; VAMP-A; VAP-33; VAP-A; VAP33 |
Locus ID | 9218 |
UniProt ID | Q9P0L0 |
Cytogenetics | 18p11.22 |
Summary | The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Tight junction |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301164 | VAPA MS Standard C13 and N15-labeled recombinant protein (NP_919415) | 10 ug |
$3,255.00
|
|
LC403661 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418581 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429151 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403661 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2 | 100 ug |
$436.00
|
|
LY418581 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1 | 100 ug |
$436.00
|
|
TP301164 | Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP314308 | Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.