VAPA (NM_194434) Human Mass Spec Standard

SKU PH301164

VAPA MS Standard C13 and N15-labeled recombinant protein (NP_919415)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201164]
• Predicted MW: 27.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC201164 protein sequence; Red=Cloning site Green=Tags(s); ; MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP; GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN; DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD; KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_919415
• RefSeq Size: 6859
• RefSeq ORF: 747
• Synonyms: hVAP-33; VAMP-A; VAP-33; VAP-A; VAP33
• Locus ID: 9218
• UniProt ID: Q9P0L0
• Cytogenetics: 18p11.22
• Summary: The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Tight junction