SCML1 (NM_001037535) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC214112] |
Predicted MW | 34.22 kDa |
Protein Sequence |
Protein Sequence
>RC214112 representing NM_001037535
Red=Cloning site Green=Tags(s) MMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSL WTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRA ELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTR SPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVK LGTAVKLCYYIDRLKQGKCFEN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001032624 |
RefSeq Size | 2693 |
RefSeq ORF | 906 |
Locus ID | 6322 |
UniProt ID | Q9UN30 |
Cytogenetics | Xp22.13 |
Summary | Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312954 | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032629) | 10 ug |
$3,255.00
|
|
LC416443 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421919 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421922 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416443 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 2 | 100 ug |
$436.00
|
|
LY421919 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3 | 100 ug |
$436.00
|
|
LY421922 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1 | 100 ug |
$436.00
|
|
TP312954 | Purified recombinant protein of Homo sapiens sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP314112 | Recombinant protein of human sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.