SCML1 (NM_001037535) Human Mass Spec Standard

SKU
PH314112
SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032624)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214112]
Predicted MW 34.22 kDa
Protein Sequence
Protein Sequence
>RC214112 representing NM_001037535
Red=Cloning site Green=Tags(s)

MMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSL
WTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRA
ELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTR
SPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVK
LGTAVKLCYYIDRLKQGKCFEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032624
RefSeq Size 2693
RefSeq ORF 906
Locus ID 6322
UniProt ID Q9UN30
Cytogenetics Xp22.13
Summary Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SCML1 (NM_001037535) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312954 SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032629) 10 ug
$3,255.00
LC416443 SCML1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421919 SCML1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421922 SCML1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416443 Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 2 100 ug
$436.00
LY421919 Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3 100 ug
$436.00
LY421922 Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1 100 ug
$436.00
TP312954 Purified recombinant protein of Homo sapiens sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1, 20 µg 20 ug
$737.00
TP314112 Recombinant protein of human sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.