Carbonic anhydrase X (CA10) (NM_020178) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213425] |
Predicted MW | 37.6 kDa |
Protein Sequence |
Protein Sequence
>RC213425 protein sequence
Red=Cloning site Green=Tags(s) MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVN IETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDS QGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITY KNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFL SMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_064563 |
RefSeq Size | 3260 |
RefSeq ORF | 984 |
Synonyms | CA-RPX; CARPX; HUCEP-15 |
Locus ID | 56934 |
UniProt ID | Q9NS85 |
Cytogenetics | 17q21.33-q22 |
Summary | This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309723 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076002) | 10 ug |
$3,255.00
|
|
PH312539 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076003) | 10 ug |
$3,255.00
|
|
LC412601 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421186 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421187 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY412601 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 2 | 100 ug |
$436.00
|
|
LY421186 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 1 | 100 ug |
$436.00
|
|
LY421187 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 3 | 100 ug |
$436.00
|
|
TP309723 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312539 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP313425 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720625 | Purified recombinant protein of Human carbonic anhydrase X (CA10), transcript variant 1 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.